PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011787
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 191aa    MW: 21937.4 Da    PI: 10.3226
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011787genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.31.5e-211153345
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  ++ks rqvtfskRr+g++KKA+EL +LC++++a+++fs+ gk
  Lus10011787 11 LNDKSCRQVTFSKRRTGLFKKAHELATLCAIQIAIMVFSPGGK 53
                 5799************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.511161IPR002100Transcription factor, MADS-box
SMARTSM004328.3E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-25277IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-19323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-211257IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGRRKIEMKM LNDKSCRQVT FSKRRTGLFK KAHELATLCA IQIAIMVFSP GGKPFCFGSP  60
DFDLISKKFL NQDQSPCVDF YNNDNNNSSG RARKMMNQKL DLLQHQIDTE KKKGDTFKEK  120
MKKPATSLGF MKLVKKMGFE ELTNIKNRSV NLQRELQRRT DEIDVLSSLL LLEGQTPIVK  180
EENRDFSYSN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-14169169Myocyte-specific enhancer factor 2B
1tqe_R2e-14169169Myocyte-specific enhancer factor 2B
1tqe_Q2e-14169169Myocyte-specific enhancer factor 2B
1tqe_P2e-14169169Myocyte-specific enhancer factor 2B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-41AGAMOUS-like 29